PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911676.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 230aa    MW: 26052.9 Da    PI: 5.5849
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911676.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM61.62.5e-19481681127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eek.ewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lp+G rF P d+ lv eyL+++++g+++    + + +d y + P+dLp+++ + +e+ + y+++ r+     g+r++    sg Wka+g+ +++ 
  XP_010911676.1  48 LPVGWRFMP-DSLLVLEYLHNHCRGHTCFSRAINEGIDPYGCRPEDLPSRFPGvGENdSNYYYADRKD----GHRQTDD-GSGHWKAKGR-EPIR 135
                     799******.778999***********8774555667***********64443344426688887755....5566664.78*******9.8999 PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyr 127
                     s++g+ +g+k+ + fy+g   + + t W+m e +
  XP_010911676.1 136 SEDGQIIGMKREFKFYSGPGDS-NPTGWLMTEHT 168
                     99**************887666.79******976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-2044181IPR003441NAC domain
PROSITE profilePS5100517.86848201IPR003441NAC domain
PfamPF023652.1E-1049167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGREEAPIFH SQSAENWEVL AFGYKSTANF SILLNFQQDF RRIKMKPLPV GWRFMPDSLL  60
VLEYLHNHCR GHTCFSRAIN EGIDPYGCRP EDLPSRFPGV GENDSNYYYA DRKDGHRQTD  120
DGSGHWKAKG REPIRSEDGQ IIGMKREFKF YSGPGDSNPT GWLMTEHTSD DTPKAICVIY  180
NTNQIGQASS NSDATNRPLP NYPNFPGIQM EQDPNLNANY NCPDLDAALP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911676.11e-175PREDICTED: NAC domain-containing protein 45-like, partial
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2942824
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.12e-16NAC domain containing protein 62